Protein Info for CCNA_03302 in Caulobacter crescentus NA1000

Annotation: nitrate/nitrite sensor histidine kinase narX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details PF13493: DUF4118" amino acids 14 to 118 (105 residues), 69.5 bits, see alignment E=4e-23 PF07568: HisKA_2" amino acids 136 to 188 (53 residues), 50.7 bits, see alignment 3.2e-17 PF13581: HATPase_c_2" amino acids 225 to 313 (89 residues), 29.3 bits, see alignment E=1.6e-10 PF02518: HATPase_c" amino acids 232 to 320 (89 residues), 38.5 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCY4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CCNA_03302 nitrate/nitrite sensor histidine kinase narX (Caulobacter crescentus NA1000)
MPISARIRGKVGGYLFAILATLVAWALRYALDDWFPPGFPYLTFFPAVVVTAYFAGLRPS
ILCAVLSGLMAWYFFIPPFHSLSLNFPTAVALVFYAFVVAVDVFFIDGMRKALRQLEEER
TRYAALAESRDLLYRELHHRVSNNLHVVGALLRLQGAGVQDEDARHALAEAGGRIELIAK
IQRELHNAVGQPAPFRSFAEVVLAGAAAAAGAKVSLAIHGGGQPLHPDQAMPVTLVMLES
FNNALEHGFGEGGSGRVEVHLDQSGLTHVLTVRDDGAGPPADFDPAQSKSLGLRIVRAMA
QQLGGQFEMSSEGGWTICRLSYAPKQD