Protein Info for CCNA_03204 in Caulobacter crescentus NA1000

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF01168: Ala_racemase_N" amino acids 22 to 245 (224 residues), 86.1 bits, see alignment E=3e-28 PF14031: D-ser_dehydrat" amino acids 266 to 384 (119 residues), 53.2 bits, see alignment E=3.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03204)

Predicted SEED Role

"Low-specificity L-threonine aldolase (EC 4.1.2.48)" (EC 4.1.2.48)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCM6 at UniProt or InterPro

Protein Sequence (402 amino acids)

>CCNA_03204 alanine racemase (Caulobacter crescentus NA1000)
MEGDNMNFPSTEHLPQTPLLVVDRAALERNLARMQALCDAAGVRLRAHGKTHKCSTLGRL
IIERGAVGLCCQTVGEAEAYVAGGIQDVLVTAPSPPWGAARLAALAKTGARIGAVADDEG
QIDRLSDAAVAAGVTLDLVVDLDLGTHRAGAYPKDALRLARAADAAPGLRFAGLQAYLGH
LQHMDDLDLRKSADEAAFATLKALVAELTEAGLPPPVVTGGGTGTHIYDLASGVYTELQA
GSYAVMDVEYDACGAPGGQAWGFEPAMAIAATVVSANHKSHVTVDAGFKAVSMDGPPARV
VAGAAPGSLWRAMGDEHGMIAHLSLIDVLKAGGRDPLGFDKAVAEADADPARAWPADAPR
VGDIVWLQPGHCDPTINLYDALHVWDGETLERWAVDGRRVSK