Protein Info for CCNA_03201 in Caulobacter crescentus NA1000

Annotation: adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00184: adenylosuccinate synthase
  • amino acids 6 to 426 (421 residues), 499.5 bits, E=4e-154
• PF00709: Adenylsucc_synt
  • amino acids 6 to 420 (415 residues), 566.4 bits, E=1.7e-174

Best Hits

Swiss-Prot: 100% identical to PURA_CAUVC: Adenylosuccinate synthetase (purA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 100% identity to ccr:CC_3103)

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

See B8H3C9 at UniProt or InterPro

Protein Sequence (428 amino acids)

>CCNA_03201 adenylosuccinate synthetase (Caulobacter crescentus NA1000)
MANVTVVGAQWGDEGKGKIVDWLSNRADVVVRFQGGHNAGHTLVVDGKVYKLALLPSGVV
QGKLSVIGNGVVVDPWHLLSEIDKIADQGVAITPDLLILADNACLILPLHRDLDQAREAA
STQKIGTTGRGIGPAYEDKVGRRAIRVADLADPEALKPKIERLLAHHGALRRGLGLPEAN
AQELFDALMELAPRILSYAQPAWRVLDQAYKAGRRILFEGAQGSLLDVDHGTYPFVTSSN
TAAGQASAGSGMGPSATGFVLGIVKAYTTRVGEGPFPAELFDEVGKHLSTVGREVGVNTG
RARRCGWFDSVLVRQSVAINGIHGVALTKLDVLDGLKTLKICVGYKIGDKVVDYLPAGLR
DQAAATPVYEEIEGWTESTAGARSFKDLNANAIKYVRRVEELIGAPVALLSTSPERDDTI
LMRDPFQG