Protein Info for CCNA_03187 in Caulobacter crescentus NA1000

Annotation: cysteine/acetylserine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF00892: EamA" amino acids 29 to 153 (125 residues), 54.7 bits, see alignment E=6.2e-19 amino acids 163 to 301 (139 residues), 49 bits, see alignment E=3.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03187)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCL2 at UniProt or InterPro

Protein Sequence (317 amino acids)

>CCNA_03187 cysteine/acetylserine efflux protein (Caulobacter crescentus NA1000)
MTPTEAQSGNTTADGTSMPQAALPLRHFLLALAVVAVWGTNFVVIRIGLDHLPPLLFATL
RFSMVLLPMAFFVKRPAVSWANLAAYGVAIGAGQFGLLFVAMKGHISPGLASLVVQTQVF
FTIGMAMWISRERVQGFQVVALLLAASGIVLIAVHGGGSATPLGVTLVLLAAASWSAGNM
ISRQAGAVNMLGYVVWASLFSIPPLFAMSLWLEGWPAIVQGVTAATPWTWAAVAWQAVGN
TMFGYAAWGWLLARHPAATVTPMALLVPVFGMGASALLLHEALPAWKLIAAALVLTGLAV
NMLWPKVRAWRAAAATT