Protein Info for CCNA_03184 in Caulobacter crescentus NA1000

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 PF02771: Acyl-CoA_dh_N" amino acids 179 to 290 (112 residues), 112.9 bits, see alignment E=2.2e-36 PF02770: Acyl-CoA_dh_M" amino acids 296 to 396 (101 residues), 61.4 bits, see alignment E=1.6e-20 PF00441: Acyl-CoA_dh_1" amino acids 411 to 560 (150 residues), 144.7 bits, see alignment E=5e-46 PF08028: Acyl-CoA_dh_2" amino acids 428 to 546 (119 residues), 55 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: K14448, (2S)-methylsuccinyl-CoA dehydrogenase (inferred from 100% identity to ccr:CC_3087)

Predicted SEED Role

"Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAZ0 at UniProt or InterPro

Protein Sequence (564 amino acids)

>CCNA_03184 acyl-CoA dehydrogenase (Caulobacter crescentus NA1000)
MTDTVSENTNETLILPGLTGLLREAADAVALFVAEAKPAVLAHIAPQGGKVDRKLADVHQ
HRVHGYGWYASYAELMNQVAGWAQRLEAEGRFGEIEALLAQLLFSEYSAQLVGGVPMNQG
EIVRPQHLVEDRAVLNRLTSEAMTRLAAEGGSQAVKARIAQRLAEARGRPTLEQTGLDET
FEMIRDQFHAFAEEKVTPFAHEWHLKDELIPLELVQELGELGVFGLTIPEEFGGSGMGKT
AMCVVSEELSRAWIGVGSLATRSEIAGELILTGGTDAQKEYWLPRIASAEILPTAVFTEP
NTGSDLGALRTRAELKGDSYVVTGNKTWITHAARADVMTLLVRTDPATTDYRGLSMLLAP
KPRGTDEAPFPAEGMSGGEIGVIGYRGMKEYELGFDGFTVPAENLLGGVTGQGFKQLMAT
FESARIQTAARAVGVAQAALEVGLSYALDRKQFGQPIFDFPRVHNKLAMMAAEIMGVRQL
TYFAAHQKDEGKRCDLEAGMAKLIAARVAWAAADNALQIHGGNGFAMEYAASRLLADARI
LNIFEGAGEIQAQVIARRLLDGGN