Protein Info for CCNA_03166 in Caulobacter crescentus NA1000

Annotation: ArsR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF12840: HTH_20" amino acids 13 to 62 (50 residues), 40.5 bits, see alignment 1.1e-14

Best Hits

Swiss-Prot: 40% identical to YDFF_BACSU: Uncharacterized HTH-type transcriptional regulator YdfF (ydfF) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03166)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCF6 at UniProt or InterPro

Protein Sequence (234 amino acids)

>CCNA_03166 ArsR-family transcriptional regulator (Caulobacter crescentus NA1000)
MDANIASPAALIGDPTRAAMLQVLQDGRAQPASALAWAAGVTAQAASNHLAKLVDGGLLA
VERQGRHRYYRLASAEVAHAIEALSVIAAPVRSLEIPRSPKARALRDARCCYGHLAGRLG
VKVCDALLDRDLIRPAGDKRYAITPEGHAWFEDLGVSSQTLRGARGVARPCLDWTERRHH
LAGPLGVKLLAAMTQRGWLALEPNGRAVRLTTNGARALLERLSVSLEDADQAAA