Protein Info for CCNA_03027 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF00512: HisKA" amino acids 242 to 299 (58 residues), 34.3 bits, see alignment 2.9e-12 PF02518: HATPase_c" amino acids 341 to 444 (104 residues), 69.8 bits, see alignment E=4e-23 PF13589: HATPase_c_3" amino acids 341 to 413 (73 residues), 32.2 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to ccr:CC_2932)

Predicted SEED Role

"Osmolarity sensor protein EnvZ (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDR0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>CCNA_03027 two-component sensor histidine kinase (Caulobacter crescentus NA1000)
MPLTRLDIPPALKRLLPTTLFGRSLLIIILPVAIMQIAVTWAFFDAHWQSVTSKLSEGLA
GDIAWAVQSYEDDPSPAAVEKLAERAEGALSLSIAFQKGRKLPTSHRPSLFAALDRSLDK
ALEDRLDNPFWFDTTRYRAYIDIRVQVDGGVLQIYALRDRAYATQGHIFILWMVVATLLL
TAVAILFIRNQVRAIERLAEAADAFGRGEDPEFKPHGAREVRQAALAFIAMKLRIQRHIE
QRTALLASVSHDLRTPLTRLKLEMAMAEPCERMEAMKGDLAEMEHMIDEYLAFARGEGGE
AIQVVDLSDLVESVVADAERGGAAIETEITQGLETRLRPLTFRRALANLIDNGVAHADRV
RVTVSPRQTGGVDVAVDDDGPGIPEDKYEEAFKPFSRLDESRNQNEKGVGLGLAIARDMA
RGLGGDLVLSRSALGGLRALIRLPG