Protein Info for CCNA_02947 in Caulobacter crescentus NA1000

Annotation: spsG-related polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03590: UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase
  • amino acids 4 to 266 (263 residues), 257.7 bits, E=7.9e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02947)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

• CMP-N-acetylneuraminate biosynthesis II (bacteria) (2/3 steps found)
• CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (1/5 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

See A0A0H3CDI2 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CCNA_02947 spsG-related polysaccharide biosynthesis protein (Caulobacter crescentus NA1000)
MSLRIVFVCAAGPSVGGGHVMRSLTLARALAARGATCAFLGTPEVAAVLDAFGPDMARAD
TAEPFEAVVFDSYALTADDHRRIAAGRPALVIDDLADRPLAADLVLDAGPARRAEDYAGL
VPAHARLLLGPNHAPVRPAFVALREAALARRAQQGPVRRILVSLGMTDVGGITGRVVALL
APILGEVTLDLVVGAGAPSLPALRALAAEDPRLVLHIDTQDMPRLVLEADLAIGAGGSTT
WERCVLALPALTLILADNQIAAARALEAAGVTPCLDVTAPDFDTAFAALAQNLIADPDRR
AALSAASATVCDGRGAERVAEAFLGVTTT