Protein Info for CCNA_02877 in Caulobacter crescentus NA1000

Annotation: portal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01537: phage portal protein, HK97 family" amino acids 99 to 441 (343 residues), 185.5 bits, see alignment E=7.8e-59 PF04860: Phage_portal" amino acids 106 to 438 (333 residues), 280.1 bits, see alignment E=1.2e-87

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02877)

Predicted SEED Role

"Gene Transfer Agent portal protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBR4 at UniProt or InterPro

Protein Sequence (442 amino acids)

>CCNA_02877 portal protein (Caulobacter crescentus NA1000)
MVTVSLGVCMASSVGWPLHRRSPVPLPQRGRRGGFSFAFPTTLHCSLFVLNSIPPERILM
LFSKPRPPEAKDSRAARLIALTTGGRPQWTPRDYGALAAEGFAKNPVAYRCVRMIAEAAA
ATPLAVFVEGRRADDHPLKRLLDRPNPEQGGPDLMEAFFGNLQVAGNAYLEAAGEGAENR
SIGELYALRADRMTVVPGPRGWPLAYDYQAAGRTVRIGRDGDGWLPVLHLKLFNPTNDYY
GLSPLEAAAFAIDVHNASSAWNKALLDNSARPSGALVYSSKDAGDRLTDEQFDRLKTELA
SVHSGTANAGRPLLLEGGLDWRAMSLSPAEMDFTEGKHAAAREIALAFGVPPQLLGIPGD
LSYANYREANAAFWRGTVVPLAQRAARALTGWLGAKVPGATIVPDLDAVPALSAERDALW
SRLQAASFLTDAERRRLAGLEQ