Protein Info for CCNA_02770 in Caulobacter crescentus NA1000

Annotation: conjugal transfer protein TrbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 164 to 166 (3 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 271 to 306 (36 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 19 to 303 (285 residues), 197.8 bits, see alignment E=1.3e-62 PF04610: TrbL" amino acids 38 to 254 (217 residues), 170.6 bits, see alignment E=2.2e-54

Best Hits

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 100% identity to ccs:CCNA_02770)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAN9 at UniProt or InterPro

Protein Sequence (451 amino acids)

>CCNA_02770 conjugal transfer protein TrbL (Caulobacter crescentus NA1000)
MDSSSAWRKKSGAGHIAYIDSGFGLLGPDVGFLTTTLIAIDVTLAGLWWALEGDDNVLGR
LIKKVLYVGAFAFILGNFKALSEVIFGSFAGLGLTAGGGGISAEDLLRPGKLASIGFYAA
HPLIAKASELTGWPEVVANVVTIALLALAWVLVVLAFFVMAIQLFVTVLEFKLTSLAGFV
LVPFAFWNKTSFLAERVLGNVISSGVKVMVLAVIVGIGAGFFDAFVATLGPDPDLDDAMT
LVLGALTLAGLSIFGPAIASGLVSGAPQLGAGAAVGTAAGAAMLVGGGAMLGAGALGAVG
AGSLATIRAGTAMGAAAGAAYQLRRATSGATGAAGVASGLSGVARAATRAASQPVRDLAS
RAASSLSGSAERGRTVAWRATGGTSPVAGEPPSTAVDGDAAGGQGVGPPAWARKLQTAQS
AHIRRHALLQTVKDGDRPGGSVSPDLSSKEN