Protein Info for CCNA_02686 in Caulobacter crescentus NA1000

Annotation: N-carbamoyl-L-amino acid hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01879: amidase, hydantoinase/carbamoylase family
  • amino acids 28 to 409 (382 residues), 395 bits, E=1.9e-122
• PF04389: Peptidase_M28
  • amino acids 64 to 132 (69 residues), 26.7 bits, E=6.8e-10
• PF01546: Peptidase_M20
  • amino acids 81 to 409 (329 residues), 81.9 bits, E=9.2e-27
• PF07687: M20_dimer
  • amino acids 221 to 314 (94 residues), 22.8 bits, E=1.1e-08

Best Hits

Swiss-Prot: 45% identical to AMAB2_GEOSE: N-carbamoyl-L-amino acid hydrolase (amaB) from Geobacillus stearothermophilus

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 100% identity to ccs:CCNA_02686)

Predicted SEED Role

No annotation

MetaCyc Pathways

• allantoin degradation to ureidoglycolate II (ammonia producing) (1/4 steps found)
• allantoin degradation to glyoxylate II (1/5 steps found)
• allantoin degradation to glyoxylate III (1/5 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)
• superpathway of allantoin degradation in plants (1/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.9

Sequence Analysis Tools

See A0A0H3CAG9 at UniProt or InterPro

Protein Sequence (427 amino acids)

>CCNA_02686 N-carbamoyl-L-amino acid hydrolase (Caulobacter crescentus NA1000)
MADGVDIGVRAKARCDALGSPPYSEIDGQLTRRFLTAAHGAALDALAGWMAEAGMSARRD
AAANLIGRYEGETHGAKALIIGSHIDSVRNGGRYDGPLGIMLGIDVVEALHRAGRRLPFA
IEVVAFGDEEGSRFPASMSCSRAIAGTLDATALEMKDAEGVSVAEALAAFGGDPANIASA
ARRPEEVLAFLEAHIEQGPVLEAEGLALGVVTAIAAQKRLMVRITGMAGHAGTTPMALRK
DPGPAAAEAILALERICRAGTDGLVGTVGRMTALPGAFNVIPGAIEFSMDIRAETSATRD
AAVEAITAEIHAIAAARDLSATVTLMQALAESPCDPSLMGLLDESLADLGLPARRLPSGA
GHDAMVMAALCPTAMLFIRCEGGISHNPAEAVTEADCALAAKAMLGFVEKLAANPLRPSR
PLRGASG