Protein Info for CCNA_02681 in Caulobacter crescentus NA1000

Annotation: tRNA (uracil-5-)-methyltransferase GidA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR00137: tRNA:m(5)U-54 methyltransferase" amino acids 8 to 472 (465 residues), 523.4 bits, see alignment E=2.2e-161 PF01134: GIDA" amino acids 10 to 390 (381 residues), 335.8 bits, see alignment E=2e-104

Best Hits

Swiss-Prot: 100% identical to TRMFO_CAUVC: Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (trmFO) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04094, glucose inhibited division protein Gid (inferred from 100% identity to ccs:CCNA_02681)

Predicted SEED Role

"tRNA:m(5)U-54 MTase gid" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAE1 at UniProt or InterPro

Protein Sequence (474 amino acids)

>CCNA_02681 tRNA (uracil-5-)-methyltransferase GidA (Caulobacter crescentus NA1000)
MTTNSTYQPVHVIGGGLAGSEAAWQIAQSGVPVILHEMRKDDATGKVITDAHQTDGLAEM
VCSNSFRSDDWQFNAVGLLHAEMRKLGSLIMSCADQHQVPAGGALAVDRDGFSTEVTKRL
SQHPLVTIVREEIAGLPPAPDGKNGWDNVIVATGPLTSPALAQAVLDLTGEGQLSFFDAI
APIIHFESINMDIAWRQSRYDKEGPGGDAAAYINCPMNKEQYEAFIDALLAGPKSEFKEW
ENVPYFDGCLPIEVMAERGRETLRHGPMKPVGLTNPRDPLVKAYAIVQLRQDNALGTLWN
MVGFQTKLKHGVQAETFRMIPGLEDAQFARLGGLHRNTFINSPKLLDKSLRMKAQPRLRF
AGQVTGVEGYVESAAMGLLTGRFAAADRKGAPIDAPPPTTALGALVEHITGGHLEAGNGP
GSFQPMNINYGLLPPLEAPKVDEDGKKIPLKERGRAKKRLMSLRALKDLDAWMA