Protein Info for CCNA_02674 in Caulobacter crescentus NA1000

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF13340: DUF4096" amino acids 10 to 83 (74 residues), 78.6 bits, see alignment E=1.7e-26

Best Hits

Swiss-Prot: 68% identical to Y4SN_SINFN: Uncharacterized protein y4sN (NGR_a01590) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02674)

Predicted SEED Role

"transposase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCQ4 at UniProt or InterPro

Protein Sequence (137 amino acids)

>CCNA_02674 transposase (Caulobacter crescentus NA1000)
MEAVLEGEVLRDDQWARIELFVPGGRKGKRGPRSNGRLFVDALLWMARSGGRWRDLPERF
GPYQTAKRRYYRWIEMGVLNRLFEAVAAEPDLEWAMLDATVIRAHAQAAGARRKRGDRTP
KRLAVLAAASEPRSTSA