Protein Info for CCNA_02553 in Caulobacter crescentus NA1000

Annotation: ATP-dependent clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 PF02861: Clp_N" amino acids 4 to 128 (125 residues), 102.3 bits, see alignment E=1.8e-32 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 5 to 745 (741 residues), 1139.8 bits, see alignment E=0 PF00004: AAA" amino acids 223 to 354 (132 residues), 51.5 bits, see alignment E=1.1e-16 amino acids 504 to 619 (116 residues), 46 bits, see alignment E=6e-15 PF17871: AAA_lid_9" amino acids 362 to 465 (104 residues), 94 bits, see alignment E=3.9e-30 PF07724: AAA_2" amino acids 498 to 658 (161 residues), 206.1 bits, see alignment E=3e-64 PF00158: Sigma54_activat" amino acids 502 to 621 (120 residues), 21.5 bits, see alignment E=1.3e-07 PF07728: AAA_5" amino acids 504 to 621 (118 residues), 44.9 bits, see alignment E=9.5e-15 PF10431: ClpB_D2-small" amino acids 665 to 745 (81 residues), 94.6 bits, see alignment E=2.5e-30

Best Hits

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to ccs:CCNA_02553)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9D6 at UniProt or InterPro

Protein Sequence (776 amino acids)

>CCNA_02553 ATP-dependent clp protease ATP-binding subunit ClpA (Caulobacter crescentus NA1000)
MPSFSRPLEESLHRAVAYANQRKHEYATLEHLLLSLTDDEDAAGVMRACDVDLAALKKSL
SNYLDVELTSLVVDDEEDAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERESH
AAYFLQEQDMTRYDAVNFIAHGIAKKAGASEPKSVKGASTGSNATEEDGDKSTTKTGGEA
LEAYCVDLNEKARQGKVDPLIGRANEVERAIQILCRRTKNNPLLVGDPGVGKTAIAEGLA
RKIVTHQVPEVLEGATIYSLDMGALLAGTRYRGDFEERLKQVVKELENHPNAVLFIDEIH
TVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEFRQHFEKDRALVRRFQKIDVNE
PTVEDTIKILKGLKTYYEDFHKLKYTADALKVAVELSAKYITDRKLPDKAIDVIDEAGAS
QMLLPESRRKKTIGVKEIESVVAKIARIPPKSVSKSDTEALKELESDLKRAVFGQDEALS
QLAAAMKLARAGLREPNKPIGSYLFSGPTGVGKTEAAKQLAQTLGIEMLRFDMSEYMERH
TVSRLIGAPPGYVGFDQGGQLTDAVDQHPHAVVLLDEIEKAHGDVYNILLQVMDNGTLTD
SNGKKVDFRNVVLIMTTNAGASDAQRNSIGFGRSKVEGEEEAALKRLFTPEFRNRLDAVV
AFKPLSADIIRQVVQKFVMQLEAQLADRNITIELSDDAADWLAKNGFDELYGARPLARVI
QEHIKKPLADDILFGRLVRGGHVKVVLKDSKIDFEIDSSTAPKAGKTDETEPAMAE