Protein Info for CCNA_02539 in Caulobacter crescentus NA1000

Annotation: aspartate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00155: Aminotran_1_2" amino acids 42 to 369 (328 residues), 177.8 bits, see alignment E=1.9e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2455)

Predicted SEED Role

"Valine--pyruvate aminotransferase (EC 2.6.1.66)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Pyruvate Alanine Serine Interconversions (EC 2.6.1.66)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCD5 at UniProt or InterPro

Protein Sequence (381 amino acids)

>CCNA_02539 aspartate aminotransferase (Caulobacter crescentus NA1000)
MRAEIEPFHAIAISRLAHQLKMEGRSIIHMEFGQPSTGAPSKALAKAHDILDAEAMGYWE
SPLLREKIAQRYQTLYGVTVEPERIILTCGASPALVLALSSLFKPGDRIALARPGYVAYR
NTLKALHLEPVEIACGPEDRFQLTAKHLADLEPAPVGVIVASPANPTGTIIEPAELEAIA
KVCAARGIRIISDEIYHGLSYAGRTPSMLEFAPDALIVNSFSKYFSMAGWRLGWLLTPPG
EDLDRARAYVGNLFLTAPSLAQHAGLAAMDCIDELEGHIDVYRANRQLMLDALPALGLKE
IAPPDGAFYIWANIAHLTDDSLGFCEDLLRDTGVATAPGVDFDPVEGKRFIRFSFAVSTP
EVEEALRRITPWFEARTASAA