Protein Info for CCNA_02525 in Caulobacter crescentus NA1000

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR00670: aspartate carbamoyltransferase" amino acids 26 to 323 (298 residues), 304.4 bits, see alignment E=4e-95 PF02729: OTCace_N" amino acids 26 to 168 (143 residues), 141.7 bits, see alignment E=1.9e-45 PF00185: OTCace" amino acids 176 to 322 (147 residues), 88.6 bits, see alignment E=4.9e-29

Best Hits

Swiss-Prot: 100% identical to PYRB_CAUVC: Aspartate carbamoyltransferase (pyrB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to ccs:CCNA_02525)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAR1 at UniProt or InterPro

Protein Sequence (332 amino acids)

>CCNA_02525 aspartate carbamoyltransferase (Caulobacter crescentus NA1000)
MTASAHDPAREAIETIRARVFAFPKRHFLSAGDLNAPQAADLLDLADAFVALNRQTSKTL
DILKGRTLMNLFFENSTRTQSSFELAGKRLGADVVNMNPKTSSVAKGETLIDTAVTLNAM
RPDLLVVRHASSGAASLLSQKVSGHVVNAGDGQHEHPTQALLDALSIRRAFGRVSGLTVA
ICGDVLHSRVARSNVALLHTLGASVRLVGPPTLMPAQAERWGVAVHHDMKSGLAGADVVM
MLRLQLERMQGAFVPSTREYFRFYGLDREKLSRAAPGAKVMHPGPMNRGVEIDSDVADDP
AVSLIQDQVEMGVAARMAVLASLAARIEGAGR