Protein Info for CCNA_02446 in Caulobacter crescentus NA1000

Annotation: glutathionylspermidine synthase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to YGIC_ECOL6: Putative acid--amine ligase YgiC (ygiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02446)

MetaCyc: 47% identical to peptide--spermidine ligase YgiC (Escherichia coli K-12 substr. MG1655)
6.3.1.-

Predicted SEED Role

"Similarity with glutathionylspermidine synthase (EC 6.3.1.8), group 1" in subsystem Glutathionylspermidine and Trypanothione (EC 6.3.1.8)

MetaCyc Pathways

glutathionylspermidine biosynthesis (1/1 steps found)

KEGG Metabolic Maps

Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAN6 at UniProt or InterPro

Protein Sequence (387 amino acids)

>CCNA_02446 glutathionylspermidine synthase family (Caulobacter crescentus NA1000)
MRRLSLTPRPNWEQQAEAVGFTWRHADGRRYWDERAAYAFTLGEVEGHLEPATEALHKLC
LELVEDAVKSDALMARLQIPETARDVVAASWTARDPSLYGRFDFFYDGDGPPKLYEYNAD
TPTSIYEAGVFQWLWLEDMIQQGALPEATDQFNSLHDQLAERFKAIFPNGGFVHFASDPD
FVEDRQTVRFLEDMGRLAGLEPKFVPTTAIGLDADGRFVDQDNYIIGALFKLYPWEDMLR
EPYAANIAGSKTLFLEPPWKAVLSNKAMLPLLWERHPGHPNLLETYFDDDPKVERLGSSY
ARKPLFSREGANIELWKDGRKGRVLDQGYGAEGWIRQELKPPPKFGVNYPVVGSWVIGDQ
PAGVGVREDRSRVTRDRSRFIPHIIEV