Protein Info for CCNA_02335 in Caulobacter crescentus NA1000

Annotation: inositol monophosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02067: histidinol-phosphatase
  • amino acids 12 to 273 (262 residues), 329.9 bits, E=5.2e-103
• PF00459: Inositol_P
  • amino acids 14 to 275 (262 residues), 175.6 bits, E=7.5e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02335)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

See A0A0H3CA67 at UniProt or InterPro

Protein Sequence (278 amino acids)

>CCNA_02335 inositol monophosphatase family protein (Caulobacter crescentus NA1000)
MTLSADRLAALDAFILDLNRASADVILPLFRADHGLEDKGAGKNLPRDTHAAFDPVTEAD
RGAEAAIRALIAQRFPDHGVIGEEYGEDRPDAEFVWVLDPIDGTRAFIAGLPLWTTLIGL
RHEGRPVLGSIGQPYVNEIFIGHAGGARLVSGGEARPIRVRECANINDAVIATTDPDACF
DGAERGAWLQVRAAAKLARLGCDAYAYAMVAMGKMDMVIEAGLKSWDIEAAIPLIEGAGG
MVTNWRGEPVGPNGGQMVISGDRRPLDEALVSLRRSAK