Protein Info for CCNA_02322 in Caulobacter crescentus NA1000

Annotation: Co2+/Mg2+ efflux protein ApaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF04379: DUF525" amino acids 44 to 128 (85 residues), 113.9 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 100% identical to APAG_CAUVC: Protein ApaG (apaG) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06195, ApaG protein (inferred from 100% identity to ccr:CC_2239)

Predicted SEED Role

"ApaG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA57 at UniProt or InterPro

Protein Sequence (154 amino acids)

>CCNA_02322 Co2+/Mg2+ efflux protein ApaG (Caulobacter crescentus NA1000)
MRSIRRETSPPMQRMRRRRGSDSAAYEARTRDIVVRVFPTYAAEESSPEQGLYLWSYTVE
IENHGEETVTLIARRWTITDGFNRVNEVEGSGVVGEQPELKPREAFRYVSNCPLPTPSGA
MRGSYQMVTDAGDLFDVAIPEFSLHLPGAAMKLN