Protein Info for CCNA_02182 in Caulobacter crescentus NA1000

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00338: phosphoserine phosphatase SerB" amino acids 73 to 281 (209 residues), 208.2 bits, see alignment E=1.1e-65 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 79 to 250 (172 residues), 104.2 bits, see alignment E=7.8e-34 PF00702: Hydrolase" amino acids 80 to 252 (173 residues), 64.5 bits, see alignment E=2.6e-21 PF12710: HAD" amino acids 81 to 248 (168 residues), 71 bits, see alignment E=2.8e-23 PF08282: Hydrolase_3" amino acids 217 to 274 (58 residues), 30.8 bits, see alignment E=3.9e-11

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to ccr:CC_2097)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C974 at UniProt or InterPro

Protein Sequence (292 amino acids)

>CCNA_02182 phosphoserine phosphatase (Caulobacter crescentus NA1000)
MSELSTIPTVLTVVGANPDAYAQAVSRVEAALSSRREGLGPLAADFFVEGGDAEPVKAAL
ADLAVDFAIQPAANRRKGLLIADMDSTIINVECLDELADFAGVKAQVSEITERAMRGELA
FEGALRERVGMLKGLGVSALQACYDERVRLNPGAETLVRTMAKHGARCALVSGGFTFFTS
RVAEAAGFHLNRANTLIELDGALTGAVGDPILGKEAKLAALREETAALGLTPADALAVGD
GANDLAMIEAAGLGVAYRAKPIVAAQADAKVDHTDLTTLLYFQGYKAEEFHA