Protein Info for CCNA_02166 in Caulobacter crescentus NA1000

Annotation: uracil DNA glycosylase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF03167: UDG" amino acids 32 to 185 (154 residues), 86.5 bits, see alignment E=9.3e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02166)

Predicted SEED Role

"Hypothetical protein VC0266 (sugar utilization related?)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C961 at UniProt or InterPro

Protein Sequence (194 amino acids)

>CCNA_02166 uracil DNA glycosylase superfamily protein (Caulobacter crescentus NA1000)
MPLDALLSEISACRACAPYLPHTPRPVTRVSTATRLLIAGQAPGRIVHETGLPFNDPSGV
RLRQWMGIDRETFYGRSEIGVAAMAFCFPGTNPKGGDYPPPPRCAALWRSQLLAALPNVE
LTLLVGRYAQEWALDGRTGKTMTETIERWREFGPNVLPLPHPSWRNTAWLKRNPWFEAEV
TPYLRRRVADILRS