Protein Info for CCNA_02136 in Caulobacter crescentus NA1000

Annotation: glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 13 to 486 (474 residues), 531.3 bits, E=1.1e-163
• PF00479: G6PD_N
  • amino acids 16 to 186 (171 residues), 167.7 bits, E=4.6e-53
• PF02781: G6PD_C
  • amino acids 189 to 486 (298 residues), 380.6 bits, E=4.5e-118

Best Hits

Swiss-Prot: 53% identical to G6PD_ZYMMO: Glucose-6-phosphate 1-dehydrogenase (zwf) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to ccs:CCNA_02136)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• pentose phosphate pathway (7/8 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• heterolactic fermentation (12/18 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See A0A0H3C940 at UniProt or InterPro

Protein Sequence (487 amino acids)

>CCNA_02136 glucose-6-phosphate 1-dehydrogenase (Caulobacter crescentus NA1000)
MAKNNDVGENGREVLVLLGGAGDLALRMLLPSLYFLELDRLLPHDLRIIGVARADHDAAS
YKALVREQLGKRATVEEAVWNRLAARLDYVPANITSEEDTKKLAERIGAHGTLVIFFSLS
PSLYGPACQALQAAGLTGPNTRLILEKPLGRDLESSKATNAAVAAVVDESQVFRIDHYLG
KETVQNLTALRFANVLFEPLWDRNTIDHVQITIAETEKVGDRWPYYDEYGALRDMVQNHM
LQLLCLVAMEAPSGFDPDAVRDEKVKVLRSLRPFTKETVAHDTVRGQYVAGVVEGGARAG
YVEEVGKPTKTETFVAMKVAIDNWRWDGVPFFLRTGKNLPDRRTQIVVQFKPLPHNIFGP
ATDGELCANRLVIDLQPDEDISLTIMNKRPGLSDEGMRLQSLPLSLSFGQTGGRRRIAYE
KLFVDAFRGDRTLFVRRDEVEQAWRFIDGVSAAWEEASIEPAHYAAGTWGPQSAQGLISP
GGRAWKA