Protein Info for CCNA_02097 in Caulobacter crescentus NA1000

Annotation: periplasmic glucan glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 64 to 81 (18 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 470 to 493 (24 residues), see Phobius details amino acids 507 to 526 (20 residues), see Phobius details amino acids 532 to 547 (16 residues), see Phobius details amino acids 559 to 579 (21 residues), see Phobius details amino acids 585 to 605 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 147 to 326 (180 residues), 32.6 bits, see alignment E=7.6e-12 PF13632: Glyco_trans_2_3" amino acids 242 to 430 (189 residues), 61.1 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 100% identical to OPGH_CAUVC: Glucans biosynthesis glucosyltransferase H (opgH) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ccr:CC_2018)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX72 at UniProt or InterPro

Protein Sequence (663 amino acids)

>CCNA_02097 periplasmic glucan glucosyltransferase (Caulobacter crescentus NA1000)
MSDRSSLFDVRSSTSVTLDQVVRRDTVEIPDEAALAMPVQPLSFWQGGARRATALTQDMN
LRRWMLGLMTIAMGVAGWKASFDTIALGGVTRLEAVVLTLLAPLFLALSLWFCTALIGFV
VLMGRPKDPLGIDSEAPMPKLHTRTAILMPVYNEDAAAVFARLRAMDASIAETGSARNFD
IFVISDTRDAQVALAEQACFARFRREANCNVYYRIRKENTGRKAGNVADWVSRWGSAYEH
MLVLDADSLMTGEAMVRLADAMERHPGAGLIQTMPMIINGQTIFARTLQFATRLYGRVAW
TGLAWWSGSESSFWGHNAIVRTRAFAETCGLPHLPGPKPFGGEVMSHDALESALLRRGGW
SVHLAPYLDGSYEESPSNLLDFATRDRRWCRGNIQHVPLIALPGLHWMSRMHLVIGVLSY
ALSPLWFFCLSAGLISRALMPELKKAAFTMADLKAAAHALIDWSEIQATAWAMIITFVLL
FGPKILGAILVLARKGEVKGFGGKRRMAAGLGVEMLLSALVAPMLMFTQTRAIVEILAGK
VGGWAAQRRDADKVDFKEAWAAMGWISLSGLILAASFWFTPDLLTATAPILAGLVLAVPL
TMLGAHKVAGLKLKANGLFMTPEERRPPAIVRAAVGAACEPPIRWFARNGRPIGPTTKIR
DAA