Protein Info for CCNA_02086 in Caulobacter crescentus NA1000

Annotation: cell division protein FtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details PF05036: SPOR" amino acids 188 to 265 (78 residues), 45.7 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 100% identical to FTSN_CAUVN: Cell division protein FtsN (ftsN) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2007)

Predicted SEED Role

"FIG00481789: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX61 at UniProt or InterPro

Protein Sequence (266 amino acids)

>CCNA_02086 cell division protein FtsN (Caulobacter crescentus NA1000)
MSDPHRGAYTPPTDAPLSFDARQPVRGARPLPMTLIISAVVLVTLVVAVVMIYRDGVRGP
NDAPQAVGTEVAQMKTPPAESSQPKDPASGLQIYHNEEPQPSATFAAPPETPLARPVAPT
ATTPVETASLPAAKPAAPAPTIESLATAAAAQKPAPKPVQVAQAAPKPVAAAPATTATAP
KPAAVSTGPASVQIGALSSPALADKAWAEAVRLAPGLAAGKGKKVETVDKNGTTLYRTSV
TGFATREAAKAFCEAIAASGKSCFVK