Protein Info for CCNA_02060 in Caulobacter crescentus NA1000

Annotation: CrcB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details TIGR00494: protein CrcB" amino acids 5 to 121 (117 residues), 87.5 bits, see alignment E=4.3e-29 PF02537: CRCB" amino acids 5 to 119 (115 residues), 94.3 bits, see alignment E=2.6e-31

Best Hits

Swiss-Prot: 100% identical to CRCB_CAUVC: Putative fluoride ion transporter CrcB (crcB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to ccs:CCNA_02060)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX35 at UniProt or InterPro

Protein Sequence (127 amino acids)

>CCNA_02060 CrcB family protein (Caulobacter crescentus NA1000)
MNKLLLVAAGGAVGSVARYLVGVGAMRVMGPGWPYGTFTVNVVGGFLMGCLASWLAHRGN
TSSETWRVMLGVGVLGGFTTFSSFSLETALMIQKRAYGQAFTYSAASVLLAIAALFAGLL
VARKVFA