Protein Info for CCNA_02011 in Caulobacter crescentus NA1000

Annotation: methylmalonyl CoA epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 4 to 130 (127 residues), 61.1 bits, E=1.4e-20
• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 4 to 132 (129 residues), 146.7 bits, E=2.8e-47
• PF13669: Glyoxalase_4
  • amino acids 6 to 117 (112 residues), 73.6 bits, E=1.6e-24

Best Hits

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 100% identity to ccr:CC_1933)

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

• methylaspartate cycle (15/19 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (7/14 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

See A0A0H3C7Z1 at UniProt or InterPro

Protein Sequence (139 amino acids)

>CCNA_02011 methylmalonyl CoA epimerase (Caulobacter crescentus NA1000)
MIGKLNHVGVATPSIDESVKMYRDLLGATSITDKWAMPEQGVWVCFVNLPNSQIELIEPY
GEKSPIHGFLAKNPKGGQHHICFEVENIYEARDALVAKGATVLGEPRIGAHGTLIIFVHP
KDMGGMLVELMETPKDAHH