Protein Info for CCNA_01994 in Caulobacter crescentus NA1000

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 9 to 393 (385 residues), 444.2 bits, see alignment E=2e-137 PF02670: DXP_reductoisom" amino acids 10 to 135 (126 residues), 131.9 bits, see alignment E=3.5e-42 PF08436: DXP_redisom_C" amino acids 149 to 232 (84 residues), 134.4 bits, see alignment E=1.9e-43 PF13288: DXPR_C" amino acids 264 to 386 (123 residues), 124.4 bits, see alignment E=4.1e-40

Best Hits

Swiss-Prot: 100% identical to DXR_CAUVC: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to ccr:CC_1917)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GWR7 at UniProt or InterPro

Protein Sequence (399 amino acids)

>CCNA_01994 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Caulobacter crescentus NA1000)
MGALTSPRKVVVLGSTGSIGLSTLSLFEESGAPVQILALTAGRNVERLIEQARRWKPSLA
VIEDESRLDDLRAGLAGTGVEAAAGADAVRDAAAMGADWVMSAIVGAAGLAPTVAAARTG
AVIALANKESLVCAGPALLAIAKAAGGSVIPVDSEHSAIFQVLQSECAHRVSRLILTASG
GPFRTWDKAAMARATPEQAIAHPNWSMGAKISVDSATMMNKGLEMIEASYLFATPEDRVD
VVIHPQSVIHSLVEYVDGSTLAQLGPPDMRAPIACAFAWPDRLPWPAPRLDLAAYGQLTF
ESPDVERFPAIGIAREALRLGGGAPAAMNAANEVAVAAFLDRRIGFLDIAGAVAGTLERM
NSLGDLSVAESDAVETAMLIDGSARRIAAEVVAQKRQRA