Protein Info for CCNA_01957 in Caulobacter crescentus NA1000

Annotation: thiazole biosynthesis protein ThiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to THIG_CAUVN: Thiazole synthase (thiG) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to ccr:CC_1880)

MetaCyc: 50% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GWN0 at UniProt or InterPro

Protein Sequence (269 amino acids)

>CCNA_01957 thiazole biosynthesis protein ThiG (Caulobacter crescentus NA1000)
MNAHVTPDSVTADSDETWTVAGRTFRSRLIVGTGKYKDYATNAAAARAAGAEIVTVAVRR
VNLTDPSQPLLVDYVKPTEFTYLPNTAGCFTGEDAVRTLRLAREAGGWDLVKLEVLSDPK
TLFPDMEETLRSLKLLVADGFQVMVYCSDDPVYARKLEEAGAVAIMPLGAPIGSGLGIQN
RVNLRIIIENAKVPVLVDAGVGTASDAAIGMELGCDAILMNTAIAEAKDPIRMAKAMKHA
VIAGREAYLAGRMQKRLYADPSSPLAGLI