Protein Info for CCNA_01941 in Caulobacter crescentus NA1000

Annotation: cysteine desulfhydrase/Selenocysteine lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00266: Aminotran_5" amino acids 8 to 326 (319 residues), 194.7 bits, see alignment E=3.7e-61 PF01212: Beta_elim_lyase" amino acids 49 to 274 (226 residues), 36.6 bits, see alignment E=5e-13 PF00155: Aminotran_1_2" amino acids 50 to 176 (127 residues), 33.9 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 100% identity to ccs:CCNA_01941)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAQ6 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CCNA_01941 cysteine desulfhydrase/Selenocysteine lyase (Caulobacter crescentus NA1000)
MNASRPSVYLDYNATAPLRPEAKDALLRALESPANPSSVHAAGRAARDLVERARAEVAAL
VGVPAGSVTFVSGGTEANALAIESAKAAGVERIIISAIEHDAVMETAKASGLPVEALPVD
NRGVADLDWLAQALDKPGKTLVCLMLANNETGVIQPVDKASTLVRAHDGWLHVDAVQAAG
KIAIDFSGLGADTLALSAHKLGGPQGVGALIAGTRATVTRRLHGGGQERGRRAGTENVAG
IAAFGAAAKVGRETLASMAEQAQWRDALAQRLKAEGAVVLGEGADRLPQTLCFAGEGFGS
EVQVMTMDLAGVMVSAGSACSSGKVKASRVVDAMGRADLAPFALRVSGGWASTEDDWIKC
GDAWLAAWKRIGARRREVA