Protein Info for CCNA_01940 in Caulobacter crescentus NA1000

Annotation: ABC transporter-associated protein SufB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR01980: FeS assembly protein SufB" amino acids 16 to 480 (465 residues), 626.1 bits, see alignment E=1.5e-192 PF19295: SufBD_N" amino acids 148 to 208 (61 residues), 42.1 bits, see alignment E=7.4e-15 PF01458: SUFBD_core" amino acids 217 to 460 (244 residues), 263.4 bits, see alignment E=1.8e-82

Best Hits

Swiss-Prot: 68% identical to Y074_SYNY3: UPF0051 protein slr0074 (slr0074) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 100% identity to ccs:CCNA_01940)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9H3 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CCNA_01940 ABC transporter-associated protein SufB (Caulobacter crescentus NA1000)
MAAVKETVETVAALEKYEHGFTTDIDQEFAPKGLSEDIVRFISAKKDEPEWMLEWRLEAY
RRWLAMDEPDWAKVSYPPIDYQDTYYYAAPKTKEGPKSLDEVDPELLAVYEKLGIPLKEQ
AVLAGVEGAPRYAVDAVFDSVSVVTTFKKELAQAGVIFCSMSEAVREHPELVRQYLGSVV
PTSDNYFACLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAKDSGQFERTLIIADKGAYV
SYLEGCTAPMRDENQLHAAVVELVLLDDAEIKYSTVQNWYPGDPETGKGGIYNFVTKRAD
CRGDRSKVSWTQVETGSAITWKYPSCVLRGEGSSGEFYSIAVTNGHQQADTGTKMIHLGA
NTRSRIVAKGISAGKSTSTYRGLVSAHPKAKGARNFTQCDSLLIGKDCAAHTVPYIEARN
GQSVFEHEATTTRLSDDQLFYCQQRGLSEEESVALLVNGFVKDVLQQLPMEFAVEAQKLV
AISLEGSVG