Protein Info for CCNA_01936 in Caulobacter crescentus NA1000

Annotation: cysteine desulfurase/selenocysteine lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 11 to 408 (398 residues), 569.6 bits, E=1.7e-175
• PF00266: Aminotran_5
  • amino acids 29 to 396 (368 residues), 481.1 bits, E=4.6e-148
• PF00155: Aminotran_1_2
  • amino acids 70 to 395 (326 residues), 41.7 bits, E=1.8e-14
• PF01041: DegT_DnrJ_EryC1
  • amino acids 78 to 209 (132 residues), 25.8 bits, E=1.3e-09
• PF01053: Cys_Met_Meta_PP
  • amino acids 91 to 205 (115 residues), 28.6 bits, E=1.1e-10

Best Hits

Swiss-Prot: 53% identical to SUFS_DICD3: Cysteine desulfurase (sufS) from Dickeya dadantii (strain 3937)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 100% identity to ccs:CCNA_01936)

MetaCyc: 50% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (2/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (2/4 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• molybdopterin biosynthesis (3/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (2/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

See A0A0H3CAQ0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>CCNA_01936 cysteine desulfurase/selenocysteine lyase (Caulobacter crescentus NA1000)
MAFDAPYDVAAIRAQFPILAREVHGKPLIYLDSAASAQKPDAVLDAMMGLARTSYANVHR
GLHTLANETTEAYEKARETVARFINAERDEVVWTKSATEAVNLVASSFGLSLNAGDEIVL
SEMEHHANIVPWHFLRERKGVVLKFIPVLDDGRLDMEAYKGLLSDKTKMVAVTHMSNVLG
TVNDVAEIVRLAHAAGAPVLLDGCQGVVHTKVDVKALDVDFYVFSGHKLYGPTGIGVLYG
KAERLAALPPYQGGGEMIASVALDKITYADPPHRFEAGTPAILEAVGLGAAIEWLNGLDR
DAIFAHEHALYERVAERLRGVNGVRILGDAPGKGAVLSFTVEGAHAHDIAQVLDRYGIAV
RAGTHCAEPLMRRFGVTSSARASFALYNTEAEADAFVDALAKARSFFS