Protein Info for CCNA_01849 in Caulobacter crescentus NA1000

Annotation: quinol cytochrome oxidase polypeptide III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF00510: COX3" amino acids 25 to 205 (181 residues), 52.5 bits, see alignment E=3.2e-18 TIGR02842: cytochrome o ubiquinol oxidase, subunit III" amino acids 28 to 207 (180 residues), 266.5 bits, see alignment E=8e-84

Best Hits

Swiss-Prot: 59% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to ccr:CC_1771)

MetaCyc: 59% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8B9 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CCNA_01849 quinol cytochrome oxidase polypeptide III (Caulobacter crescentus NA1000)
MGAHSQAVSAADTDQFYLTKEHHPENGTLLGFWIYLMSDCLIFAVLFACYAVLGQSYAAG
PSGADLFDLKLVAINTGLLLLSSITYGFAMIAAQAREVRPVLIWLGVTGLLGVGFLSLEI
YEFAHLIHEGATPQRSAFLSAFFLLVGTHGLHVTFGVIWLVTLMVQVAQRGLGIEMRRRL
MCLSMFWHFLDVIWIGVFSFVYLLGVLK