Protein Info for CCNA_01804 in Caulobacter crescentus NA1000

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 5 to 112 (108 residues), 152.1 bits, E=3.6e-49
• PF00578: AhpC-TSA
  • amino acids 7 to 96 (90 residues), 30.1 bits, E=4.3e-11

Best Hits

Swiss-Prot: 57% identical to GPO_LACLM: Glutathione peroxidase (gpo) from Lactococcus lactis subsp. cremoris (strain MG1363)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 100% identity to ccr:CC_1730)

MetaCyc: 56% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

See A0A0H3C8V1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>CCNA_01804 glutathione peroxidase (Caulobacter crescentus NA1000)
MAMSIYDYSAKTLDGQDVSLADYRGQVLLIVNTASKCGFTPQYEGLEALYKAHKDRGFTV
LAFPCNQFGAQEPGNAEEIANFCSLTYDVSFPVMSKIDVNGADAHPLYKFLKKEQKGVLG
TEAIKWNFTKFLIGKDGQVVDRFAPTVKPEDLKVAVEALL