Protein Info for CCNA_01726 in Caulobacter crescentus NA1000

Annotation: EngA-subfamily GTPase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 TIGR00231: small GTP-binding protein domain" amino acids 3 to 157 (155 residues), 82 bits, see alignment E=6.1e-27 amino acids 177 to 342 (166 residues), 94.2 bits, see alignment E=1.1e-30 PF02421: FeoB_N" amino acids 4 to 123 (120 residues), 44.7 bits, see alignment E=5.2e-15 amino acids 180 to 344 (165 residues), 40.2 bits, see alignment E=1.3e-13 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 436 (433 residues), 556.2 bits, see alignment E=8.4e-171 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 99.5 bits, see alignment E=6.5e-32 amino acids 180 to 298 (119 residues), 87.2 bits, see alignment E=4.3e-28 PF00009: GTP_EFTU" amino acids 179 to 348 (170 residues), 44.5 bits, see alignment E=6.7e-15 PF04548: AIG1" amino acids 180 to 280 (101 residues), 34.4 bits, see alignment E=7.4e-12 PF14714: KH_dom-like" amino acids 356 to 436 (81 residues), 105.2 bits, see alignment E=8.7e-34

Best Hits

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to ccs:CCNA_01726)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA55 at UniProt or InterPro

Protein Sequence (588 amino acids)

>CCNA_01726 EngA-subfamily GTPase protein (Caulobacter crescentus NA1000)
MPLKLAIVGRPNVGKSTLFNRLAGKKLAIVDDQPGVTRDRRYASGSLGDLELELIDTAGF
EDVDDSSLEARMRAQTEAAIEEADVSLFVFDSREGVTALDEVFAAILRKRDKPVIVAANK
AEGKAGEAGAGEAFRLGLGEPIPISGEHGEGMAELYAALLAFEPQVEAGDDEDDDSKPIR
IAIIGRPNAGKSTLVNRLLGEDRLLTGPEAGITRDSISVDWEWDGRKIRLVDTAGLRRKA
KVQDKLEKLSTADTIRAITFAEVVLLVMDATHPFEIQDLQIADLAEREGRAVVFVLAKWD
LIEDQAAHLTAFREHAERMLPQLRGAPVVALSGETGKGIGHLMPAVIKTHRDWSTKVKTR
DLNDWLQMAMQRHPPPAVSGRRVKPKYMAQTKARPPTFVLFSSRADQMPDHYRRYLINSL
RESFDLPGVPLRITIKSGANPYADGEAKGHSGRGKREFERREREEERIRASRNTVKKSKR
LAAEAAAKAAEAAGLPDPGKVAVKPVKKKGPAVAKAAPSEAAGVSEPGKAAVKSVKAKGP
RAQKKVATTPSYKVGTKTAGGKAAAPRRPAAGSRTVRGNTGPGRPKGR