Protein Info for CCNA_01698 in Caulobacter crescentus NA1000

Updated annotation (from data): 3-keto-glycoside 1,2-lyase
Rationale: Specifically important in carbon source D-Raffinose pentahydrate. Raffinose utilization which appears to proceed via the 3-ketoglycoside pathway. This protein is in a conserved cluster with the 3-ketoglycoside pathway starting with lacABC. Distantly related to BT2157, which is a 3-ketoglycoside lyase. This protein has a signal peptide so is probably periplasmic. Note that another protein from this family (CCNA_01705) is also involved. Because raffinose is a trisaccharide, it is not clear which cleavage is performed by CCNA_01698.
Original annotation: endo-1,3-1,4-beta glucanase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06439: 3keto-disac_hyd
  • amino acids 55 to 256 (202 residues), 157.6 bits, E=2e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01698)

Predicted SEED Role

"putative multi-domain protein"

Sequence Analysis Tools

See A0A0H3C8R4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>CCNA_01698 3-keto-glycoside 1,2-lyase (Caulobacter crescentus NA1000)
MTIKAITGLASFAVGMALLSATASAQTRPEDTEVWKPVPAVVTPASAPGGAPSDAIILFD
GRNLDQWVTAADKSPAGWTVADGVITVDKARGNIETKRAFRDYQLHLEWRIPADIAGSGQ
GRGNSGVFLASTGSRDQGYEVQILDSYQSATYVNGQAGAVYKQHPPLANANRKPGEWQTY
DIIWRAPVFGSDGALTTPASVTVLHNGVLVQDNAVLAGETVYIGKPGYKAHGPSPIKLQA
HGDPSIPISFRNIWVRELAPR