Protein Info for CCNA_01674 in Caulobacter crescentus NA1000

Annotation: circularly permuted ATP-grasp type 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 PF04174: CP_ATPgrasp_1" amino acids 93 to 424 (332 residues), 494.7 bits, see alignment E=1.2e-152 PF14403: CP_ATPgrasp_2" amino acids 93 to 468 (376 residues), 554.7 bits, see alignment E=9.9e-171

Best Hits

Swiss-Prot: 53% identical to Y2411_MYCTU: Uncharacterized protein Rv2411c (Rv2411c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1602)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C758 at UniProt or InterPro

Protein Sequence (506 amino acids)

>CCNA_01674 circularly permuted ATP-grasp type 2 protein (Caulobacter crescentus NA1000)
MAAKTQTLADTPTLPMTEAAYLPGVAYDEMFTPEGEVRQHYDPLHGRMSTLGAEELAARQ
RTLERSFLLQGITFTVYGAENTTERIIPTDLFPRIIPASEWARIEAGLTQRLRALNLFLA
DIYGDQQILMDGVVPRELVLGAPSYRREMQHLYVPHKAYANVCGSDLIRCQDGQFAVLED
NLRVPSGVSYMLANRDAAKRTFPGTYRAAGVRPVERYPDLLLSTLKSMAADWRADPQVVV
LTPGVYNSAYYEHAYLARLMGVPLVEGRDLVVHENMVYMRTTTGLRRIDVIYRRVDDDFI
DPLTFRRDSSLGAAGLFNAYRAGNVVICNAPGTGVADDKAVYAYVPDIIRYYLGEDAILP
NIETYLCREPRQLSHVLANLDKLVVKAVGASGGYGMLVGPHASQKERDDFALAIKADPEN
YIAQPTIQLSTAPCLVDGRIEPRHVDLRPFILSGEKTIVTPGALTRVALKRGSLVVNSSQ
GGGSKDTWVLADDAPSNGNGHGSARP