Protein Info for CCNA_01664 in Caulobacter crescentus NA1000

Annotation: potassium-transporting ATPase B chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 591 to 609 (19 residues), see Phobius details amino acids 620 to 640 (21 residues), see Phobius details amino acids 660 to 683 (24 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 21 to 680 (660 residues), 959.8 bits, see alignment E=6.4e-293 TIGR01494: HAD ATPase, P-type, family IC" amino acids 80 to 349 (270 residues), 102.5 bits, see alignment E=1.9e-33 amino acids 376 to 604 (229 residues), 148.1 bits, see alignment E=3e-47 PF00122: E1-E2_ATPase" amino acids 113 to 215 (103 residues), 73 bits, see alignment E=1.5e-24 PF00702: Hydrolase" amino acids 308 to 534 (227 residues), 91.3 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 100% identical to KDPB_CAUVC: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to ccr:CC_1592)

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7Y6 at UniProt or InterPro

Protein Sequence (686 amino acids)

>CCNA_01664 potassium-transporting ATPase B chain (Caulobacter crescentus NA1000)
MSSPDIHADQGRRALAGGLSRAVLARAVKEAFLKLDPRQLTGNPVIFATWIVALLATVSA
VAAVVGQQPAGFAIQIAVWLWATVVFANLAESVAEGRGKAAADSLRATRVTTKAKLIVDP
NTGTWIPTPAHKLGVGEVILVEAGEVIPTDGEIIEGMASVNEAAITGESAPVIRESGGDR
SAVTGGTTVVSDWIKMRVTAEAGSTFLDRMIAMVEGADRRKTPNEIALAVLLAGLTLIFL
IAVVTLLGPGKFSGVALDPLVLGALFITLIPTTIGGLLSAVGIAGMDRLLKVNVLATSGR
AVEAAGDVDTLLLDKTGTITFGNRMATEVIPAPGVRPDAAMKAALMASLADETPEGRSII
ELARNAGLALEAPEGATAIPFTAQTRQSGLDHQGRSWRKGAVDAVYRTLGLEPQSIPTEL
SVAVDRIARSGGTPLAVSEDGVLVGVIHLKDVVKPGVKERFADLRRMGLRTVMITGDNPV
TAAAIASEAGVDDFLAEATPEDKLRLIREEQGKGRLVAMCGDGANDAPALAQADVGVAMQ
TGAQAAREAGNMVDLDSDPTKVIEIVEVGKQMLITRGALTTFSIANDVAKYFAIIPAMFV
VSLPALGALNVMKLHSPESAILSAVIFNALVIVALIPLALKGVKYRAVGAGKLLSRNLTL
YGLGGLIAPFVGIKLIDLVVSALGLA