Protein Info for CCNA_01648 in Caulobacter crescentus NA1000

Annotation: adenosylmethionine-8-amino-7-oxononanoate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR00508: adenosylmethionine-8-amino-7-oxononanoate transaminase" amino acids 14 to 417 (404 residues), 524.5 bits, see alignment E=8.1e-162 PF00202: Aminotran_3" amino acids 26 to 416 (391 residues), 387.4 bits, see alignment E=6.7e-120

Best Hits

Swiss-Prot: 50% identical to BIOA_SALTY: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (bioA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00833, adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC: 2.6.1.62] (inferred from 100% identity to ccs:CCNA_01648)

Predicted SEED Role

"Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)" in subsystem Biotin biosynthesis (EC 2.6.1.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C742 at UniProt or InterPro

Protein Sequence (420 amino acids)

>CCNA_01648 adenosylmethionine-8-amino-7-oxononanoate (Caulobacter crescentus NA1000)
MSDPRWLTEGAPHVWRPYCQMKTARPPLPVVATRGARLILEDGRELVDGLASWWTACHGY
NHPHIAGALRKQIETMPHVMFGGLAHEPAYRLAKRLARLLPGDLDHVFFAESGSVAVEIA
MKMALQYQINRGVGGRTRFLAFRGGYHGDTLATMTVCDPEEGMHSLFAGVMPAQVIADLP
RDPASEAALDALLAARGHEIAAMLVEPLIQGAGGMLPHPPEVLRTLRRLADKHGVLLIFD
EIFTGFGRTGSLFAMQAAGVEPDIVTLSKALTGGTLPLSAAVARRHVFEAFWSDDPAAAL
MHGPTYMANPLACAAANASLDLFEDGAWARDVARVSAALAEGLEPCRAGEGVVDVRTLGA
IGVVEFEAPVPVSDLCARFAALGVWIRPMGKVVYLTPAFTTPDEDLSRLTSAVRQVVGVD