Protein Info for CCNA_01644 in Caulobacter crescentus NA1000

Annotation: chemotaxis motB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details PF13677: MotB_plug" amino acids 12 to 65 (54 residues), 72.6 bits, see alignment E=1.5e-24 PF00691: OmpA" amino acids 185 to 275 (91 residues), 44.5 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 100% identity to ccr:CC_1573)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8L1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>CCNA_01644 chemotaxis motB protein (Caulobacter crescentus NA1000)
MAVNSEQPIIIKKVKKGGGHGHHGGAWKVAYADFVTAMMAFFLLMWLLNTTSPEQKQGIA
DYFAPASISSTTSGSGGILGGTSLGDDGAKADGKLSVVQQMAPEAQDVTKEAQSSETANL
DSASEQALRDALAKKEQDSFASAAQSLRQSLQDMPELAELSKQILIDQTPEGLRIQLVDQ
EGRSMFKENSREPNDRARVLLRAVAKVINQLPNRVTISGHTSANAFGKKQDGDWALSAQR
ADASRQVLRSAGVDDDRVYQVSGKANSEPLYADDPTLAGNRRISIVLLREKPVLPDGL