Protein Info for CCNA_01567 in Caulobacter crescentus NA1000

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR01249: prolyl aminopeptidase" amino acids 22 to 356 (335 residues), 289.3 bits, see alignment E=1.7e-90 PF00561: Abhydrolase_1" amino acids 51 to 343 (293 residues), 99 bits, see alignment E=7.3e-32 PF12697: Abhydrolase_6" amino acids 52 to 344 (293 residues), 34.5 bits, see alignment E=6.9e-12 PF12146: Hydrolase_4" amino acids 64 to 165 (102 residues), 33 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1499)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8E6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CCNA_01567 proline iminopeptidase (Caulobacter crescentus NA1000)
MDFSKLRTTSKVTTEWSYPQGQPLRTGWLRVDTAPDHELYWEEYGRADGEPVMFLHGGPG
GACAPVMSRFFDPDRYRVILFDQRGCGKSRPTVAADGPDKALANNTTDHLVSDINALREA
LGISGKMHVFGGSWGSTLALVYAIRHPEKVASLILRGIFLGRKEDLLYMYQGNAATYQAQ
PYALTAPGAYITYPDEWKAFVEVIAPEQRGDMMAAYKAIFDTVPTTDTERAAQLKAALAW
SVWEGTISNMIPAAEDAGKFGEAEFALSFAQIEAHFFAHDLFLKEDEITDGVAALTGVPV
HIVHGRFDQVCPLTQGSRLVQALEAAGLPPATYVITDAGHSAMEAQTVIALTAIMDGLPR
L