Protein Info for CCNA_01545 in Caulobacter crescentus NA1000

Annotation: NAD(FAD)-utilizing dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF03486: HI0933_like" amino acids 5 to 391 (387 residues), 313 bits, see alignment E=7e-97 PF01266: DAO" amino acids 5 to 102 (98 residues), 29.7 bits, see alignment E=2.5e-10 PF00890: FAD_binding_2" amino acids 5 to 53 (49 residues), 38 bits, see alignment 6.2e-13 PF12831: FAD_oxidored" amino acids 5 to 143 (139 residues), 33.6 bits, see alignment E=1.4e-11 TIGR00275: flavoprotein, HI0933 family" amino acids 6 to 391 (386 residues), 410.3 bits, see alignment E=3.9e-127 PF13450: NAD_binding_8" amino acids 8 to 40 (33 residues), 26.2 bits, see alignment 3.9e-09 PF22780: HI0933_like_1st" amino acids 188 to 338 (151 residues), 150.4 bits, see alignment E=2.1e-47

Best Hits

Swiss-Prot: 53% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 100% identity to ccr:CC_1477)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7P9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CCNA_01545 NAD(FAD)-utilizing dehydrogenase (Caulobacter crescentus NA1000)
METFDVVVIGAGAAGMMCAIEAGKRGRSVLVIDHAKAPGEKIRISGGGRCNFTNTGASIH
NFLSANPKFALSALRRYRPRDFIALVERYGIAYHEKTLGQLFCDGSAKQIITMLLTEMKA
AGVTLRLETSVESVAKAVSGFEVSLSSGKVACASLVVASGGKSIPKMGATGLGYDIAKQF
GLNIIETRPALVPLTFEAGMLARLTPLSGVALDAVVGHGKTKFQEGMLFTHRGLSGPSIL
QISSYWREGDEIRVDMAPGVDALAALKTARTATPRQAVATVLATLLPKRVAQVIAEEEAP
DKGNIADCSDKVLGRLASAVNAWTFKPVGSEGYRTAEVTLGGVDTEALDSRTLEAKAVPG
LFFIGEVVDVTGWLGGYNFQWAWASGWSAGQSV