Protein Info for CCNA_01492 in Caulobacter crescentus NA1000

Annotation: 3-mercaptopyruvate sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00581: Rhodanese" amino acids 10 to 129 (120 residues), 56.1 bits, see alignment E=2.3e-19 amino acids 158 to 271 (114 residues), 43.9 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 41% identical to THTM_HUMAN: 3-mercaptopyruvate sulfurtransferase (MPST) from Homo sapiens

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 100% identity to ccs:CCNA_01492)

MetaCyc: 41% identical to 3-mercaptopyruvate sulfurtransferase (Homo sapiens)
3-mercaptopyruvate sulfurtransferase. [EC: 2.8.1.2]; 2.8.1.- [EC: 2.8.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C879 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CCNA_01492 3-mercaptopyruvate sulfurtransferase (Caulobacter crescentus NA1000)
MSTPSDPLVTTAWLAQHLEAPDVRVVDASWHMPAAQRDPHKEFLAAHIPGAVFFDIDEIA
DESTDLPHMIPSPTKFASRVRKLGLGDGSRIVVYDSTGILPAARVWWHFRAMGHEDVVVL
DGGLPKWISEGRPIEDGPAFPQERHFTPRYQADVYRSLDQMRDIVATGREQIVDARAAGR
FEGVDPEPRAGLRGGHMPGARNIPLSALIAPDGTMLSAEKLKSVFEAAGVDINKPVVSTC
GSGITASVVALALARMGKPRSAVYDGSWTEWGGLADTPVVTGPAQ