Protein Info for CCNA_01448 in Caulobacter crescentus NA1000

Annotation: fructose-1,6-bisphosphatase, class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00330: fructose-1,6-bisphosphatase, class II" amino acids 7 to 312 (306 residues), 347.4 bits, see alignment E=4.3e-108 PF03320: FBPase_glpX" amino acids 8 to 313 (306 residues), 450.3 bits, see alignment E=1.4e-139

Best Hits

Swiss-Prot: 52% identical to GLPX_BACSU: Fructose-1,6-bisphosphatase class 2 (glpX) from Bacillus subtilis (strain 168)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 100% identity to ccs:CCNA_01448)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C840 at UniProt or InterPro

Protein Sequence (317 amino acids)

>CCNA_01448 fructose-1,6-bisphosphatase, class II (Caulobacter crescentus NA1000)
MSSNTLDRALVLDAVRVTEAAAIASWTMLGRGDEMAADQAAVDAMRNALNELDIDGEIVI
GEGERDEAPMLYIGEKVGTGKGPRIDIALDPLEGTTLAAKSQPNALTVMAWAPKGTLLNA
PDTYMDKIACGPGLPAGVIDLDRSPAENIQAVADAKGVALSEITVCVLDRPRHAEIIASV
RAVGARIHLITDGDVAGVINTTDPLTGIDLYLGSGGAPEGVLACAALKCVGGQFQGRLLF
RNADERARAARWGVTDLDKKYDLHEIVRDEAIFAATGVTRGGLLDGVVYRDGCVHTHTLV
MNSSTGTVREVRMKRKV