Protein Info for CCNA_01446 in Caulobacter crescentus NA1000

Annotation: LL-diaminopimelate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF00155: Aminotran_1_2" amino acids 31 to 382 (352 residues), 205.3 bits, see alignment E=8.1e-65

Best Hits

Swiss-Prot: 65% identical to AATC_RHIME: Putative aminotransferase AatC (aatC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14261, alanine-synthesizing transaminase [EC: 2.6.1.-] (inferred from 100% identity to ccs:CCNA_01446)

MetaCyc: 51% identical to glutamate--pyruvate aminotransferase AlaC (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-, 2.6.1.1

Use Curated BLAST to search for 2.6.1.- or 2.6.1.1 or 2.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7C8 at UniProt or InterPro

Protein Sequence (406 amino acids)

>CCNA_01446 LL-diaminopimelate aminotransferase (Caulobacter crescentus NA1000)
MSTDFHRIRRLPPYVFEEVNKIKARLRAEGTDIIDFGMGNPDMPTPQHIVDKLIETARDP
KAGRYSASKGVPGLRKAMANYYGRRFGVKLNPDTEVIATLGSKEGFANLAQALTGPGDVI
ICPNPAYPIHAFGFIMAGGIIRHVPALSPEEYLSNISRAVKHSVPPPSVLILSYPSNPTA
QWVDLDFYKDAVALAKKHDLLVISDVAYGEIYFDNNPPPSILQVDGAKDIAVEVNSLSKT
YAMAGWRVGMVVGNARICAALARVKSYLDYGAYTPVQVAAATALNGPQDCVDEIRGIYKS
RRDTLIKSMKAAGWDIPNPPASMFAWAKIPEAYREAGSMLFSRLLIEEAGVAVAPGIGFG
EYGEGYVRIGLVENEHRIRQAARNVKKFIANADSILAKAHNKMEQA