Protein Info for CCNA_01438 in Caulobacter crescentus NA1000

Annotation: heme O monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details PF02628: COX15-CtaA" amino acids 15 to 333 (319 residues), 375.5 bits, see alignment E=1e-116

Best Hits

Swiss-Prot: 100% identical to CTAA_CAUVC: Heme A synthase (ctaA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to ccs:CCNA_01438)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H551 at UniProt or InterPro

Protein Sequence (343 amino acids)

>CCNA_01438 heme O monooxygenase (Caulobacter crescentus NA1000)
MTSFLRSDRSRPVAIWLFIVAAMVFAMVVVGGATRLTDSGLSITEWQPIMGALPPMSEQA
WRESFELYKQIPQFQLVNPDMTLEGYKEIFWWEWAHRLLGRTVGAVYAIPLIVFLIRRDI
PRRLIWRCAAMLGLGGLQGLVGWWMVSSGLSERVSVAPERLMTHLGLALALFVLLIWTAL
DAWNGSPRVEERSPWRGWALAFLGAVFFQSLLGALVAGNDAGFVYNDWPLMNGRFFPGDY
GGAGLWGTLAHSQAAVQFNHRIFAYALLLAAVVLVVLARRDRLLVGQGKSLATAVAAVVF
LQAALGVWTLMAAVPISLGVLHQAGAAVLLAVATAFAWRVRRP