Protein Info for CCNA_01416 in Caulobacter crescentus NA1000

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07991: KARI_N" amino acids 3 to 106 (104 residues), 24 bits, see alignment E=8e-09 PF03807: F420_oxidored" amino acids 3 to 93 (91 residues), 33.9 bits, see alignment E=1.2e-11 PF02826: 2-Hacid_dh_C" amino acids 3 to 93 (91 residues), 28.9 bits, see alignment E=2.2e-10 PF03446: NAD_binding_2" amino acids 3 to 158 (156 residues), 158.2 bits, see alignment E=5.8e-50 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 6 to 291 (286 residues), 476.3 bits, see alignment E=1.7e-147 PF14833: NAD_binding_11" amino acids 163 to 290 (128 residues), 117.3 bits, see alignment E=1.5e-37 PF21761: RedAm-like_C" amino acids 175 to 291 (117 residues), 27.5 bits, see alignment E=9.8e-10

Best Hits

Swiss-Prot: 49% identical to MMSB_MYCTU: Probable 3-hydroxyisobutyrate dehydrogenase (mmsB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 100% identity to ccr:CC_1354)

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9B4 at UniProt or InterPro

Protein Sequence (298 amino acids)

>CCNA_01416 3-hydroxyisobutyrate dehydrogenase (Caulobacter crescentus NA1000)
MTRIAFIGLGNMGGGMAANQAKAQHQVRAFDLSAAAVERAVAAGCLAAASVAEAVAEAEI
VITMLPAGPHVRAVYAEQILPNAPKSALLIDCSTIDVDSARVVARQAAEAGFRFADAPVS
GGIMAAEAGTLAFMVGCEASDFAAVEAALAPMSRVTIHAGDHGAGQAAKICNNMLLGVSM
LGTCEAFALAEKLGLAADRFFEIASKSSGQCWSITSYCPVPGVGPQTPADRGYEGGFASA
MMLKDLKLAQEAAAKAGASTPMGAQAEALYALFDANGFGGKDFSAVIELLRGRVADLH