Protein Info for CCNA_01396 in Caulobacter crescentus NA1000

Annotation: tetratricopeptide repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13432: TPR_16" amino acids 186 to 247 (62 residues), 30.6 bits, see alignment E=3e-10 amino acids 381 to 432 (52 residues), 20.9 bits, see alignment 3.2e-07 amino acids 416 to 480 (65 residues), 36.7 bits, see alignment E=3.6e-12 amino acids 487 to 541 (55 residues), 33.7 bits, see alignment 3.2e-11 PF13429: TPR_15" amino acids 414 to 542 (129 residues), 27.9 bits, see alignment E=1.3e-09 PF13176: TPR_7" amino acids 485 to 515 (31 residues), 14.3 bits, see alignment (E = 3e-05) PF07719: TPR_2" amino acids 487 to 514 (28 residues), 26.1 bits, see alignment (E = 5.1e-09) PF13181: TPR_8" amino acids 487 to 513 (27 residues), 18.9 bits, see alignment (E = 1e-06) PF13174: TPR_6" amino acids 487 to 512 (26 residues), 14.5 bits, see alignment (E = 3.8e-05) PF13414: TPR_11" amino acids 490 to 529 (40 residues), 35.1 bits, see alignment 6.9e-12 PF14559: TPR_19" amino acids 493 to 548 (56 residues), 31.2 bits, see alignment 1.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1335)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C996 at UniProt or InterPro

Protein Sequence (576 amino acids)

>CCNA_01396 tetratricopeptide repeat family protein (Caulobacter crescentus NA1000)
MTRLKVLLACVSVSALAACASGPAQVSMRGPVGQNYSLFDTRTSYGQFLAGQAALRDGNS
KEAATYFGTAAVLGEDPGVIAERSFTALLLSGEISRAAAAAPTEAGGTEAIRRLGVLTRV
VEALALGKGKEAQALLKSDPPGFPHQQAVALLGPWAAAAAGDKEGAIVQPVLRNDKLVQY
FGQQGQARLFERAKRYDEAETDYKALTSNAATASIFTLDYGAFLERRKRYDDALALYDAA
LRAAPNDTGLLRARARAAARSAPPSAPTLRQGAAEGLIACAATFAGERQNQFALAYLRLA
LRLDPGRDEAWILVGDLLNQGDDHQAAIEAYGRVPAGAPLYASAQSKIAWAWSALGDKTK
ALDVARAALTAAPNDRDAAVALADLLRASSRWDESVAVLDLLLAREAEAPDWRLLYMRAI
ALEQGGRWPEAEKDLQTALKVNPDEPDLLNFLGYSWIDRNERLPEALAMVEKAVAARPQS
GAMMDSLGWAYFRLGDYKTAIEKLEAAVELEPGDPDINGHLGDAYWKAGRTIEARFQWQR
VLSLEPTDKQKADSEDKLKNGLGLSTPATKSTIAHN