Protein Info for CCNA_01389 in Caulobacter crescentus NA1000

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 320 (308 residues), 76.1 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01389)

Predicted SEED Role

"FIG00481761: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7T6 at UniProt or InterPro

Protein Sequence (337 amino acids)

>CCNA_01389 acetyltransferase (Caulobacter crescentus NA1000)
MGLQGHQAGRRYEALDGLRGIAAIGVLLYHVGSWTGRPWLVPHGYLAVDFFFCLSGFVLA
HAYGRRDITWLGFMRQRLVRLWPLIVLTMLGGAFVIIQNREAVPGWLALGLLMIPRVWID
ETGFSPLFPLNPPAWSLFFELAVGAAWFPLRRLGVLGHVLLVVLLLPVMLYVAHGMGGVL
TGWDRGTFVISFLRTIFAFLLGWGCYRIQAFVTWTAPVWALALLLGAVVCAPWTPLNWLY
DFACVSVVFPLMVLAGRRDPDGLAAQVCRAAGAISYPLYALHWLGWELLLRAYRALGGEG
YPAGFAITGVLLIVLGSWVVLKVYDEPVRRRLRALGT