Protein Info for CCNA_01388 in Caulobacter crescentus NA1000

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF13489: Methyltransf_23" amino acids 182 to 338 (157 residues), 49.7 bits, see alignment E=1.1e-16 PF01209: Ubie_methyltran" amino acids 188 to 296 (109 residues), 44.4 bits, see alignment E=4e-15 PF13847: Methyltransf_31" amino acids 189 to 293 (105 residues), 40 bits, see alignment E=1e-13 PF13649: Methyltransf_25" amino acids 194 to 285 (92 residues), 70.3 bits, see alignment E=5.8e-23 PF08241: Methyltransf_11" amino acids 195 to 289 (95 residues), 66.2 bits, see alignment E=1e-21 PF08242: Methyltransf_12" amino acids 195 to 287 (93 residues), 50.3 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01388)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C786 at UniProt or InterPro

Protein Sequence (355 amino acids)

>CCNA_01388 methyltransferase (Caulobacter crescentus NA1000)
MDQSTRARTRTAFAIDAVGQGAKAAVKAVWWTATGGLARSLTRPTEGPQARRFTPAAPPP
VPGSLRRAYLEAFEKDARDVAAGLYPAIEDGPIRPSAALREAVDFLVDAFEVDQRRRRGD
GAEVRNAADPSVYPNYYRQNFHYQSGGWFTAESAGRYDAQVEALFSGTAGAMRRRGLSLL
ARHWRGRDHRDAKILDVACGSGAFLKDLSAAFPRAALAGLDLSEAYLAKARKRTAVGGVK
AKAETLPFGDATLDAVTCVYLFHELPPRVRPVVAASLARVLKPGGVLVLVDSVQPVDTPD
LARLLEAFPVYFHEPYYSSYAETNLEALFAEAGLRLLDQDCAFLTKAMLFVKPGG