Protein Info for CCNA_01376 in Caulobacter crescentus NA1000

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 118 to 136 (19 residues), see Phobius details PF02798: GST_N" amino acids 20 to 99 (80 residues), 45.8 bits, see alignment E=1.6e-15 PF13417: GST_N_3" amino acids 23 to 102 (80 residues), 38.8 bits, see alignment E=2.3e-13 PF13409: GST_N_2" amino acids 29 to 99 (71 residues), 40.4 bits, see alignment E=9.6e-14 PF00043: GST_C" amino acids 144 to 222 (79 residues), 29.5 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K11209, GST-like protein (inferred from 100% identity to ccr:CC_1316)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C976 at UniProt or InterPro

Protein Sequence (234 amino acids)

>CCNA_01376 glutathione S-transferase (Caulobacter crescentus NA1000)
MPDLSVFPITQRWPAERPDQIQLYSLPTPNGVKVSIMLEETALPYEPHLIDIGQNETWST
EYLSLNPNGKIPAIIDPNGPEGKPIALFESGAILVYLAEKTGQFLPSDPAARYEALQWVF
FQMAAIGPMFGQLGFFHKFAGREYEDKRPLQRYVAESKRLLGVLEGRLADRSWLMGEAYT
IADIATLGWVRNLVGFYEAGDLVGYADLQHVPRWLEAGLARPAVQRGLQSPARP